PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_33813-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 352aa    MW: 38771.7 Da    PI: 4.2004
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_33813-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.6e-1267109246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g++++ E++l+++++   G++ W+ Ia+ ++ gRt +++k++w++
  TRIUR3_33813-P1  67 GPFSQGEEDLIIHLHSIRGNK-WSQIAAQLP-GRTNNEVKNFWNT 109
                      799******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-54772IPR009057Homeodomain-like
SuperFamilySSF466893.59E-1747119IPR009057Homeodomain-like
PROSITE profilePS5129418.11662115IPR017930Myb domain
SMARTSM007172.8E-1065113IPR001005SANT/Myb domain
PfamPF002491.1E-1067109IPR001005SANT/Myb domain
CDDcd001673.16E-768111No hitNo description
Gene3DG3DSA:1.10.10.608.0E-1973112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGLICNAKHR RCVLVQKTAN PTELVRVAVL NGQMDGINRV LINLGLERCG KSCRLRWMHY  60
MTPDRGGPFS QGEEDLIIHL HSIRGNKWSQ IAAQLPGRTN NEVKNFWNTI IKKKLRQRRI  120
DPAIHKPLAH AGAAAAATPV TRTAVFSEAE LILSSPVGTQ PMPPLVSAES YVYSRGSMDG  180
AGGAHAALGG CSDDGSLSSL SGYNNNQTAD FPGYLDADAL HGAVIPSVWS SRTLNWMAGE  240
MADEELTDIM VDMEFGELMK DWIEDWSDDE NSDREDRSEN GNEWDDLNID ELDDDQENNS  300
ELSNEDYISQ FISECYNAYD YYGESDAETG LNDESLDAPG SGESESSVII SE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-154811540108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3537850.0AK353785.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1002L23.
GenBankAK3582100.0AK358210.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1071D01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958441.16e-63PREDICTED: myb-related protein Zm1-like
TrEMBLT1NSL80.0T1NSL8_TRIUA; Uncharacterized protein
STRINGSi029872m4e-61(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6026522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-36myb domain protein 86